SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000001213 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000001213
Domain Number 1 Region: 42-172
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 5.51e-29
Family Insect phospholipase A2 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000001213
Sequence length 174
Comment pep:novel group:AMEL2.0:Group7:2036312:2037783:1 gene:ENSAPMG00000000731 transcript:ENSAPMT00000001213
Sequence
MRVLHSSFLLLVLCLFLHVSAREWEIQHKEADDEIQERINTIVPSTKWCGPGNKAKNYND
LGFNHITDACCREHDYCPDSIKALRRKHNLWNASLFLRSKCSCDHKFYKCLKNSTELIAV
GIGKVYFNDIIIPKCFELEHPIIGCKKYEDYRCIKYIVDKKKPKKYQWFDLPSF
Download sequence
Identical sequences A0A087ZZK8
XP_001120293.1.77095 7460.XP_001120293 ENSAPMP00000001213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]