SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000001869 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000001869
Domain Number 1 Region: 94-186
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.3e-30
Family Insect phospholipase A2 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000001869
Sequence length 186
Comment pep:known group:AMEL2.0:GroupUn:22291171:22297057:-1 gene:ENSAPMG00000001104 transcript:ENSAPMT00000001869
Sequence
MLAVFLLLIPTLWGDETEASVLVADTTMSRMVELNADAPFCALYTDRGVIQKMVLGADPK
KVRQMSSNLVADLEETCKASRDKGKNQPAGGGLIYPGTKWCGPGTLAKSYDELGHHAAED
ACCREHDHCPITISPKECIHGICNNSPFTRSHCDCDAKFRRCLQNLNSEVANTLGALFFN
VIQVTC
Download sequence
Identical sequences ENSAPMP00000001869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]