SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000002657 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPMP00000002657
Domain Number - Region: 154-188
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0186
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000002657
Sequence length 203
Comment pep:novel group:AMEL2.0:GroupUn:20571947:20572567:1 gene:ENSAPMG00000001540 transcript:ENSAPMT00000002657
Sequence
VDAGFSSKIILSDETHFHLDSFLNRQNCRIWGSENLCVISEKQMHPQRVTVWCRFWAGSI
IGPYFFENEAQAATVNSARYRDMITQFFLPKLDDDVANMWFQQDANETIQLLHETFPGRV
LSRFGDQNWLPRSCDLTPLNFFLWYLKSKIYVNNSTITRALQEEIKRCINEIQPQLYRKV
MKNFDKRCQQNRGGHLPDVLFYK
Download sequence
Identical sequences ENSAPMP00000002657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]