SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000009376 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000009376
Domain Number 1 Region: 35-165
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.15e-39
Family Insect phospholipase A2 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000009376
Sequence length 167
Comment pep:known group:AMEL2.0:Group13:1137065:1138324:1 gene:ENSAPMG00000005403 transcript:ENSAPMT00000009376
Sequence
MQVVLGSLFLLLLSTSHGWQIRDRIGDNELEERIIYPGTLWCGHGNKSSGPNELGRFKHT
DACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMY
FNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY
Download sequence
Identical sequences B7UUK1 P00630
ENSAPMP00000009376 NP_001011614.1.77095 7460.P00630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]