SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000015652 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000015652
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.62e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000017
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000015652
Sequence length 273
Comment pep:novel group:AMEL2.0:GroupUn:24547620:24550940:1 gene:ENSAPMG00000008955 transcript:ENSAPMT00000015652
Sequence
LKLYNTVIEDVISGVRESFIDEGVDEQVLQELKQIWETKLMSSKAVELNPDPPEPQVPQI
NTHKTVNKGNHFVQQTGNSAPQQTSQQQQQQSQQSPQQSQTQTQCHSTTTGIQHTGTPVQ
QLVTSSSAVMDRQVPIQITLPPQTGVPDAPLRVLTIQVPASAIQGTNQLHTILTGPVITA
AMGLPANLASTFDDKEEEENDEATAREEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKIT
RSRNKWKFYLKDGIMNLSGKDYVFQKMNGDAEW
Download sequence
Identical sequences ENSAPMP00000015652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]