SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000019240 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000019240
Domain Number 1 Region: 313-440
Classification Level Classification E-value
Superfamily Plus3-like 1.27e-45
Family Plus3 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000019240
Sequence length 662
Comment pep:novel group:AMEL2.0:Group2:2840859:2843818:-1 gene:ENSAPMG00000007039 transcript:ENSAPMT00000019236
Sequence
IMPKRKNHALIDSDSSGSASESGSDLDNDLLSLAKKKKGKAQDDSQSNEETSNIKKDNKH
DSDTSDSDDDWGTKAGKNKKKKVPTKRNKRKMTKSSSEESASEKEPEKVSEPEEGEVSDS
DASVSDSSQEEFNDGYDDKLMGDAEDQARLAQMTEKEREQEIFKRIEQREIMKTRFEIEK
KLRIAPDPKERSKDRKKTIEEKQDKKFHAMSLLKARREEKEKEKQRIEQQQQQSKDIEEE
ELEDDHKGGANKTKLKASDIYSDDSGSSDSGEEEDITKPSSQRRSSSSDSRDTDSDTDKN
NKAKPKKPIYVSTKEDLNKIRLSRHKMERFVHLPFFDRVVQGCFVRIGIGNNNGKPVYRV
AEISGVCETGKIYQLGGTRTNKGLKLRHGAQERVFRLEFVSNQEFTESEFFKWKETCALQ
GISMPTFEEVEQKLKDIKEALVYEFKEEDIEKIVREKERFKQTPYNYAMKKAQLMRERDA
ANCRGDDETASRLNQELSELEERASELDKMRTATISSISYINDRNRKKNVEEAEKAIMEE
FKANKGKKVDDPFTRRSTKPRMVFKPEDEEVSSTALVNDKVSPQQTETVTVCNEKENGQE
TKKKQSTEDLFNAHDFDITIDLEVPIPNNPVSVLPKPISNIKDTGPRRSLNLEDYKKKRG
LI
Download sequence
Identical sequences ENSAPMP00000019240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]