SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000021366 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000021366
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 3.92e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00016
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000021366
Sequence length 112
Comment pep:novel group:AMEL2.0:Group2:8538400:8539868:1 gene:ENSAPMG00000013493 transcript:ENSAPMT00000021359
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAIKVLLQFDKAINQALATRVKSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEVAIVDKVKIVACDGKTLDGDAAAKR
Download sequence
Identical sequences A0A087ZWY8 V9IKI4
ENSAPMP00000021366 XP_006615778.1.66377 XP_016910661.1.2121 XP_017760728.1.86738 XP_623063.1.77095 7460.XP_623063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]