SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000021972 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000021972
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily PTS system fructose IIA component-like 1.96e-25
Family EIIA-man component-like 0.0018
Further Details:      
 
Domain Number 2 Region: 127-166
Classification Level Classification E-value
Superfamily PTS IIb component 0.00000000000000262
Family PTS IIb component 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000021972
Sequence length 166
Comment pep:novel group:AMEL2.0:GroupUn:297475454:297475979:1 gene:ENSAPMG00000010341 transcript:ENSAPMT00000021966
Sequence
EKNKIILLTHGGWGAALIKSMGLLVGKTENIMDIGLTANMTLDQYMLKIENSVMPVNKNT
IVLTDIPGGTTSNVALRLTQKYPWTILSGVNALMLVETIMHQNEDITAEIVKKILEAGQQ
KVKDKNMNVVLCRVDSRLIHGQVVTKWVGQYNVNRIIVVSDQLEKD
Download sequence
Identical sequences ENSAPMP00000021972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]