SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000022685 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000022685
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-21
Family Kringle modules 0.00074
Further Details:      
 
Domain Number 2 Region: 280-371
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-19
Family Kringle modules 0.0026
Further Details:      
 
Domain Number 3 Region: 87-176
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-18
Family Kringle modules 0.0017
Further Details:      
 
Domain Number 4 Region: 183-278
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-16
Family Kringle modules 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000022685
Sequence length 373
Comment pep:novel group:AMEL2.0:GroupUn:68947978:68954157:1 gene:ENSAPMG00000009695 transcript:ENSAPMT00000022681
Sequence
KGMEYRGSIAKTAGDIRCQSWFIQNPVHEVSKDITDNDFPEKSMKTAKNYCRNPTGDNRG
PWCYTLEPTLIDDECDVPLCNFGGTQSGPGADYGGTKDFTRTRSKCKTWHKRLQLKTGEV
VKFKENQFPDKSIKEAENFCRNPTGDVGGPWCYVDEENFEYVVKEYCDVSFCDDKESDAV
EDPWPPNCLSDLRDYDYRGTQWTSINEIPCIPWISKDIPSEMKNDKKFIDGSALKALNKC
RNPTHDPKGPYCYAYTPWESETIKKRHCKIRKCRSIVFLECRMAGTANDYMGKLIKTRSG
RACMSWPPKLVGIVGQEVFNDSRYPDGSALNASNYCRNPSRNIGGAWCYTFDPSLPKDLC
NVRDCDKPVYPNI
Download sequence
Identical sequences ENSAPMP00000022685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]