SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000027403 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000027403
Domain Number 1 Region: 251-378
Classification Level Classification E-value
Superfamily Plus3-like 1.06e-45
Family Plus3 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000027403
Sequence length 559
Comment pep:novel group:AMEL2.0:Group2:2841099:2843767:-1 gene:ENSAPMG00000007039 transcript:ENSAPMT00000027401
Sequence
SASESGSDLDNDLLSLAKKKKGKAQDDSQSNEETSNIKKDNKHDSDTSDSDDDWGTKAGK
NKKKKVPTKRNKRKMTKSSSEEEFNDGYDDKLMGDAEDQARLAQMTEKEREQEIFKRIEQ
REIMKTRFEIEKKLRMVDRAPDPKERSKDRKKTIEEKQDKKFHAMSLLKARREEKKTKRK
KKNKEEELEDDHKGGANKTKLKASDIYSDDSGSSDSGEEEDITKPSSQRRSSSSDSRDTD
SDTDKKKSISTKEDLNKIRLSRHKMERFVHLPFFDRVVQGCFVRIGIGNNNGKPVYRVAE
ISGVCETGKIYQLGGTRTNKGLKLRHGAQERVFRLEFVSNQEFTESEFFKWKETCALQGI
SMPTFEEVEQKLKDIKEALVYEFKEEDIEKIVREKERFKQTPYNYAMKKAQLMRERDAAN
CRGDDETASRLNQELSELEERASELDKMRTATISSISYINDRNRKKNVEEAEKAIMEFKA
NKGKKVDDPFTRRSTKPRMVFKPEDEEVSSTALVNDKVSPQQTETVTVCNEKENGQETKK
KQSTEDLFNAHDFDITIDL
Download sequence
Identical sequences ENSAPMP00000027403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]