SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000032842 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000032842
Domain Number 1 Region: 1-371
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 6.67e-128
Family ArgJ-like 0.000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000032842
Sequence length 377
Comment pep:novel group:AMEL2.0:GroupUn:167762381:167763592:-1 gene:ENSAPMG00000016379 transcript:ENSAPMT00000032841
Sequence
RLDLSLMEFAPNTTVAGVFTKNKCPGAPIDWCRKILYRGKARGLLVNAGIANVFTGQAGF
DAVKYSAQAAAKTINCAPEEIFVASTGVIGEQLPYQKIINYLPELYSKLASDQWKETAQA
ILTTDTFAKGFSLKTDIDNIPVTIQGIAKGSGMIAPDMATMLCFVTTDAKLPATVLQKLL
NEKVKTTFNSITVDSDTSTSDTLLLFATGQTPNTEINDIDDPRLSNFSNALEKLLQELAL
LVIRDGEGVTKLIEIKVEGAVNNESAFKIGQSIGNSPLVKTAITGEDANWGRVVMAVGKA
GEPADRDLLSVAIGNIWVAKQGEVLSDYDQDKVNKHMQEQVIKIKVNLNLGEGHAKIWSC
NLTQGYIEINGSYKKKK
Download sequence
Identical sequences ENSAPMP00000032842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]