SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000034047 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000034047
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily Ribosomal protein L1 6.28e-16
Family Ribosomal protein L1 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000034047
Sequence length 145
Comment pep:novel group:AMEL2.0:Group11:11577624:11578291:1 gene:ENSAPMG00000014731 transcript:ENSAPMT00000034046
Sequence
MLSKDLKHEIEYALRKTVMQIHSYGDTHIVQVGHTFMKKKEILENILATCRYLSKNYPGG
WVNIRSIRIKTSISLGLPIYMTLKNKCLVDVPVMQPRRPKAYHNVSGELTTAPGIATVTV
TPEGDITVKKIKRRIFLQKKNLQNK
Download sequence
Identical sequences ENSAPMP00000034047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]