SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000035561 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000035561
Domain Number 1 Region: 70-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.18e-36
Family Single strand DNA-binding domain, SSB 0.0000616
Further Details:      
 
Domain Number 2 Region: 416-519
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-25
Family Single strand DNA-binding domain, SSB 0.0057
Further Details:      
 
Domain Number 3 Region: 198-227,343-406
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-24
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 
Domain Number 4 Region: 4-68
Classification Level Classification E-value
Superfamily BRCA2 helical domain 4.84e-21
Family BRCA2 helical domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000035561
Domain Number - Region: 228-341
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.00373
Family BRCA2 tower domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000035561
Sequence length 519
Comment pep:novel group:AMEL2.0:Group11:11429442:11431814:1 gene:ENSAPMG00000005046 transcript:ENSAPMT00000035562
Sequence
MYRFLSCPGVDPNLLSSGWVENHYKWIVWKLASIDRIKLGSVMLPRMLTPTRVVMELKYR
YDREIDRSERSALRKILEKDDVATKRMVLCVSSIIYDDSATNKSPNQYKMLSKKLILTDG
WYSIQASIDEAMIKYIMSGKIKEGTKLLTYGSELLNCAQGCPPLEIPENVCLKLHTNSTR
RAKWDVKLGYMISQGPICIKLKSIFPNGGLIGKIKVIIARVYPMLYHEKTSTGESIVFRN
IRCEEKANIIYEKKCRSMIETFYAKAEKYFYTGKNKNDLNTDSIDLATIEWNENCDGLSK
EFLSEQEIDQIKNDCRMKEEKFKQELESRLQESLPPPRQVTPVLKIRVIEEETSAILSVW
SPSEEVLDILKEGNYVSVSTVMPSAKRGNELQLTTNRNTIFCRINDININFSQRIYTALY
DINKPIFTPAYGEFDTVGIVTSIGNEPYGMKNFQAVYLAYPHMDSQSSYLSILFWHGIFF
YGYTEILTVGSFVACSNLEWRRATTWDIPMAYCTERSTF
Download sequence
Identical sequences ENSAPMP00000035561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]