SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000003173 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000003173
Domain Number 1 Region: 809-1021
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000222
Family Tropomyosin 0.0056
Further Details:      
 
Domain Number 2 Region: 428-684
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000049
Family Tropomyosin 0.0053
Further Details:      
 
Domain Number 3 Region: 297-395
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000003173
Domain Number - Region: 58-100
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00405
Family N-terminal coiled coil domain from apc 0.0032
Further Details:      
 
Domain Number - Region: 708-820
Classification Level Classification E-value
Superfamily Tropomyosin 0.0288
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000003173
Sequence length 1029
Comment pep:novel group:AMEL2.0:Group5:3535437:3539295:-1 gene:ENSAPMG00000001843 transcript:ENSAPMT00000003173
Sequence
QILEDKAKLEEYYKSKVETLEAKLDEQASLSAELEDLRNELEDQRAKNKELEACCKDMDA
LEKKLSELEKKRSELEKELEDNRGELERLQKENLDLKDVIEVERAEKDKLRDLLEESKKL
KEDNENLWAQLERLRGENDDLMGQKKALEDLNKQLNEDNESMKRTMGNLEARIDSLSNEL
SNVERERDALLDENESVKRELERTLTENENLKTELDKADEQLDKLKTERNELQRNFDTMK
LENETLKENVKALKDDLEESKREVDEMKAVGDALKDKEELKDAEFRELQQSSMKDALGKC
VDEIEKLKTENKDLKSEVQGLESERDRLTNEVADLKPKISELQEKLTDASKKLDEAKTED
SDLRAEVDRLKKELESAGKEIDQLKAEMNSLKNGLNKCVEEMEKLTNENSELKSQVHGLR
GEGDSLASELTNVKDENSALKDEKDQLNKQLAENKTENERLKKQNDELESENTKIKKELE
SCKNENNNLKEENNKLKEELEKLGEQLKSLNDETNKLRRELKEAEDKIQILEPQLSRARS
ENEKSQNELAVLRNEANELKVKLDREMLDNTNMRNALKILEDQVLDLNKKLDNCREENDA
LKEENKDLKTKLSDTGQVVLNLKTECDNLKEDIASLQKTIEQLKQKIADQEAEIDHWKVE
HCKFELDNEKLKADLEKVLKDLNELSEIAKKAIESDLIKLKNEKDDLNKNMTDLTSQLDR
QKRSLEAEKSAKDRGDVQIASLNSELEALKKELEKLRADNSKYKSEIDDLGKQLASAKNE
LNDCREEIVVLKNANSALRSELDPLRSLKDDYSRLTTELDGLKSENTKLLQDKRSLEDEF
GKLRGEGDGQRVEIDRLRTTLDAEKTAAEKLKSDLQSCKDENDKLQTQINEMKRSLDKMG
TENDRLKREVDESRKKLEDMEAKVKSLENQLSNLSAEKEELVKELYRTREDLNNLRNELE
KQTGVKDTMEKESTNLKEELKALKEELNKTRDENDRLKNENDKLNAEIARLNKQLDALKD
ESANLKNDI
Download sequence
Identical sequences ENSAPMP00000003173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]