SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000007648 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000007648
Domain Number 1 Region: 78-162,190-287
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000000302
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000007648
Sequence length 298
Comment pep:known group:AMEL2.0:Group2:6161684:6163041:1 gene:ENSAPMG00000004425 transcript:ENSAPMT00000007648
Sequence
MNFILIPFFLAANIPVDRPNEWIFGPVYVFNANFSYTVLADVLDEPLLSIHVTTTMRCRP
KMIDRLYCSFDGIRVGERNYPEVSILDKSYSFLIEFSPRGVENLRFPTVMEDEGLNTVRN
IVKQLSVGTDLRENVNSMPVFFSKERHALGDCPTLFSVFEYENARGQTRDEEEEGKNYKL
EILPLPQRRSNSVVVIGKTMESSRCAKLQEPVDGKSELNVKMSKSTSKMHVSDDAFRSRT
EMHVKMVNPAQRNFIVQDVSSVELVGIEPAEQPLPLLNYEHVVNLRFKEGIMHNLYMI
Download sequence
Identical sequences A0A088ALL5
ENSAPMP00000007648 7460.XP_397519 XP_397519.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]