SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000012918 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000012918
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.2e-21
Family ADP-ribosylglycohydrolase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000012918
Sequence length 128
Comment pep:known group:AMEL2.0:GroupUn:57372721:57373702:1 gene:ENSAPMG00000007397 transcript:ENSAPMT00000012918
Sequence
SEPQPYKIQLGIIKSLISENNEGPHDEKVIQKLGNSVAALYSVPTAIFCFLRAQKPIIAI
QTENPFRRAIQYAISLGGDTDTIGSMTGAIAGAFYGEEKISNNLLQHCEASEEFKVLGDK
LFEISIAQ
Download sequence
Identical sequences ENSAPMP00000012918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]