SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000016729 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000016729
Domain Number 1 Region: 15-247
Classification Level Classification E-value
Superfamily L domain-like 2.38e-40
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 242-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000124
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000016729
Sequence length 706
Comment pep:known group:AMEL2.0:Group6:9268981:9276188:1 gene:ENSAPMG00000009565 transcript:ENSAPMT00000016729
Sequence
WTAQCASSCKCRWISGKKAAECIRQNLSQIPVGLSPEIQNFDLTGNRITYLMHESFSRVH
LVNLQKLVLRKCEIELIHTDAFNGLKIVIEIDLSANNIGTLYPGTFEETQRLRVLLLNDN
KLKVLENGLFHNLKYLQKVELSNNELERIDDKTFRNLPELRSLTLDANNLSALKVQSFET
LPKLGSLELHNNPWNCNCRLKRFRDWTIEKKLYTKPTTCQQPESLAGKMWDEISSDEFAC
RPEIFTIGPSVRVEVGKGNVTFWCRASGIPRPQLSWVHRSRVINNHTRRHNGEKIYILKS
NHEWLNLTIPDVAHSDKGDYVCLAKSPGGNTEKNVTLTIAGDALGGKDNIISLPLALGLG
VTALLLLIVTVTLCVCYCRRRRIRHDEKSLEAASMEHHGLGEQEKSLITTINPVVKPPRR
EQEKSLITTINPVVKPPRRYEAPSAADGIGGGVGSGVIGGVGDDEREERATPELESGTGT
LCRGGGGSYRQYPPDLLAFSGGRGASPTSQASTAPDNTRLPSQHATPATAAFGSPSNNQY
PAAFKTLPHNRSVTPYGITSSTIAPVMPRHGYVTIPRRPRAPSWSSGPPTSPTDGLEPVY
DNLGLRTTADGSSVLSLNKSPEPLSTMRNRPLPGTPGSHYGTIQRSTPNILTSSPLDRSA
PEGAAEWPSKIADESTDSTNQLLGQQSSSTLNRKVPPRPPPKPKKK
Download sequence
Identical sequences ENSAPMP00000016729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]