SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000019930 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000019930
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily L domain-like 1.62e-29
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 173-287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.036
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000019930
Domain Number - Region: 277-364
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000314
Family Hormone receptor domain 0.0058
Further Details:      
 
Domain Number - Region: 496-570
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0785
Family Carbonic anhydrase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000019930
Sequence length 960
Comment pep:novel group:AMEL2.0:GroupUn:95678546:95682565:-1 gene:ENSAPMG00000014588 transcript:ENSAPMT00000019925
Sequence
CPKYCTCKPGAQAEWLRIKCNNELQNIRDINIDSVSVELVQLYLSKNNIYAIEANIFKNL
TNLKRLNLSRNDITFIGEDCFNGLENLERLKLNENRLTTLMEGTFYSLKFLKQLDLSNNP
WRCDCELYWFSNWIYNSSIKLSPAPKCASPLNVKGEFVKELKYSENIQCQWLPPTIELRP
IHNQVVFAGDSITLKCRAPSITEDKNAKLSWLWYPNTTSEIIDLNSFLDPQKSLSNIKID
NRYLTDSGIVDSSLSIVPVKEEHNGQWNCLLVSTNGNRSKTISVIVISEETRYCPLIAVT
KNNKGMYTWPKTVVGWKAELPCEGNHLSGLMHMPLKASYQCNITGYWENLNTELCPYISH
ITKSLEQFSKVNLSLTKINLLETAKKFKNYTGNAIKITDPIEINFITQTIEEKELGSMLI
DVISTLINVPKNILRKAEISFKSCTRIIKAVEKIIEFTPSIQFYKKNMALEEFRVKRDSF
TGLICTWYSNNNPEIRFLQCTTNNRTSPINIKDRVIEASIHLPASLLHYSHEIVAYQLMI
SVYSNNRLFPKINNNDNMDIASCVIGIISNLFLDGMSVQNLTEPVYIMLKVPLYYYAGKK
LLPVVWDETLNKSGGWTSDGCHLRNVLNNLIVFHCNRLGYYGLLQDTSSFDYDDNRNGAK
FRYSNPAIYIGSIATITCLIFMSVTYIICYTSITMPKKAKHCVINTWFAMALLSFFYSIG
IYQTENIPICQGVGLILHYLSLCPLLWMAVFDSNMYKKLSKSDLEDIPDNELQDQPLPKP
LLGLYLVGWGIAMIICGISGAINLREYAGYSYCFLTSGPALVALFVPVGILIMYLVIFHL
LIKCSIQNVDMNAQLSEGTQATENMDLELLEPNTNISVDRNSARSAQTVLSDIEDSEHSQ
ITQLKGSWITAAAAITKPLNAYISFDETIFATLYSFFSSSLGIFILFFYGIARNDVRSQW
Download sequence
Identical sequences ENSAPMP00000019930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]