SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000024221 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000024221
Domain Number 1 Region: 2-290
Classification Level Classification E-value
Superfamily SIS domain 3.11e-64
Family mono-SIS domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000024221
Sequence length 294
Comment pep:novel group:AMEL2.0:GroupUn:266621913:266622801:-1 gene:ENSAPMG00000010532 transcript:ENSAPMT00000024218
Sequence
DEHFAEAVTTILDCRGRVIITGMGKSGHIGRKIAASMASTGTPAYFVHPAEAGHGDLGMI
VDGDVLIALSNSGESEEILALIPAIKRKHVQLICITGKTSSSMAKHADIHLCAHVSQEAC
PLGLAPTSSTTAVMVLGDALTVALLRARQFTPEDFALSHPAGSLGKRLLLTVADVMHGGQ
DMPLVQEDTPLREAIVTMSEKGLGMLLVVNTAGELCGLFTDGDLRRLFQDNQQLKEWLMA
DVMGHTPKTITADRLATEALKIMQENHVNGLAVIDANNRPGALNMHDLLQARIV
Download sequence
Identical sequences ENSAPMP00000024221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]