SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000027439 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000027439
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily L domain-like 1.84e-37
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 152-258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000425
Family I set domains 0.025
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000027439
Domain Number - Region: 245-334
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000131
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000027439
Sequence length 927
Comment pep:novel group:AMEL2.0:GroupUn:95678531:95682359:-1 gene:ENSAPMG00000014588 transcript:ENSAPMT00000027438
Sequence
LSKNNIYAIEANIFKNLTNLKRLNLSRNDITFIGEDCFNGLENLERLDLSKNQISTIDTY
TFKTLSNLKRLKLNENRLTTLMEGTFYSLKFLKQLDLSNNPWRCDCELYWFSNWIYNSSI
KCPAPKCASPLNVKGEFVKELKYSENIQCQWLPPTIELRPIHNQVVFAGDSITLKCRAPS
ITEDKNAKLSWLWYPNTTSEIIDLNSFLDPQKSLSNNSGIVDSSLSIVPVKEEHNGQWNC
LLVSTNGNRSKTISVIVISEETRYCPLIVTKNNKGMYTWPKTVVGWKAELPCEGNHLSGL
MHMPLKASYQCNITGYWENLNTELCPYISHITKSLEQFSKVNLSLTKINLLETAKKFKNY
TGNAIKITDPIEINFITQTIEEKELGSMLIDVISTLINVPKNILRKAEISFKSCTRIIKA
VEKIIEFTPSIQFYKKNMALEEFRVKRDSFTGLICTWYSNNNPEIRFLQCTTNNRTSPIN
IKDRVIEASIHLPASLLHYSHEIVAYQLMISVYSNNRLFPKINNNDNMDIASCVIGSKLY
GMSVQNLTEPVYIMLKVPLYYYAGKKLLPVVWDETLNKSGGWTSDGCHLRNVLNNLIVFH
CNRLGYYGLLQDTSSFDINGAKFRYSNPAIYIGSIATITCLIFMSVTYIICYTSITMPKK
AKHCVINTWFAMALLSFFYSIGIYQTENIPICQGVGLILHYLSLCPLLWMAVFASNMYKK
LSKSDLEDIPDNELQDQPLPKPLLGLYLVGWGIAMIICGISGAINLREYAGYSYCFLTSG
PALVALFVPVGILIMYLVIFHLLIKCSIQNVDMNAQLSEGTQATENMDLELLEPNTNISV
DRNSARSAQTVLSDIEDSEHSQITQLKGSWITAAAAITKPLNAYISFDETIFATLYSFFS
SSLGIFILFFYGIARNDVRSQWLKMGC
Download sequence
Identical sequences ENSAPMP00000027439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]