SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000031269 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000031269
Domain Number 1 Region: 796-1038
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000425
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 391-606
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000051
Family Tropomyosin 0.00084
Further Details:      
 
Domain Number 3 Region: 298-410
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000719
Family Tropomyosin 0.003
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000031269
Domain Number - Region: 620-732
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number - Region: 128-170
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00523
Family N-terminal coiled coil domain from apc 0.0032
Further Details:      
 
Domain Number - Region: 954-1213
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000031269
Sequence length 1238
Comment pep:novel group:AMEL2.0:Group5:3532241:3540129:-1 gene:ENSAPMG00000001843 transcript:ENSAPMT00000031268
Sequence
IDIEDLMNKISDLLNTLRQSEINLLGLEGLKSKLEHLEPELYELRESKEEIMEELNMMRD
TLKERNDQIIQILEDKAKLEEYYKSKVETLEAKLDEQASLSAELEDLRNELEDQRAKNKE
LEACCKDMDALEKKLSELEKKRSELEKELEDNRGELERLQKENLDLKDVIEVERAEKDKL
RDLLEESKKLKEDNENLWAQLERLREQLNEDNESMKRTMGNLEARIDSLSNELSNVERER
DALLDENESVKRELERTLTENENLKTELDKADEQLDKLKTERNELQRNFDTMKLENETLK
ENVKALKDDLEESKREVDEMKAVGDALKDKEELKDAEFRELQQKNDDLRTRSSELEHKLD
NVKKELDKVESENADLRAKIDNLEKELEKDKKEIEQLKLEISSLKDALDKCVDEMEKLKV
ENEKLKNELNRLKQELESGRKEIDQLKSEIGSMKDALGKCVDEIEKLKTENKDLKSEVQG
LESERDRLTNEVADLKPKISELQEKLTDASKKLDEAKTEDSDLRAEEENNKLKEELEKLG
EQLKSLNDETNKLRRELKEAEDKIQILEPQLSRARSENEKSQNELAVLRNEANELKVKLD
REMLDNTNMRNALKILEDQVLDLNKKLDNCREENDALKEENKDLKTKLSDTGQVVLNLKT
ECYSFTIAKKAIESDLIKLKNEKDDLNKNMTDLTSQLDRQKRSLEAEKSAKDRGDVQIAS
LNSELEALKEEIVVLKNANSALRSELDPLRSLKDDYSRLTTELDGLKSENTKLLQDKRSL
EDEFGKLRGEGDGQRVEIDRLRTTLDAEKTAAEKLKSDLQSCKDENDKLQTQINEMKRSL
DKMGTENDRLKREVDESRKKLEDMEAKVKSLENQLSNLSAEKEELVKELYRTREDLNNLR
NELEKQTGVKDTMEKESTNLKEELKALKEELNKTRDENDRLKNENDKLNAEIARLNKQLD
ALKDESANLKNDIENLNERNAELSKELAVAKDSIQEVDDLKRQLKEAKKELDKPSPELDT
LKSTNKKLQDDLDNARNESLNLKNDLDNLQNDYNNLQTELADVKEERDTFRERAAALEKD
LVRVKRENEELVEQNETLRTELDDCRGENNRLLKELEKLKSENVKLQDNLINARSEGERL
KEDLNKLKKDYSDLRTDLTKAREDRDVRKEKDMELDKEIDELKAVNKENEKLRKQVTKLK
AENDKLKKALDILNKRIAALQKQIAEKQMEAGWKLQEL
Download sequence
Identical sequences ENSAPMP00000031269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]