SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|103486949|ref|YP_616510.1| from Sphingopyxis alaskensis RB2256

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|103486949|ref|YP_616510.1|
Domain Number 1 Region: 127-331
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-45
Family D-glucarate dehydratase-like 0.0000926
Further Details:      
 
Domain Number 2 Region: 11-119
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.23e-27
Family Enolase N-terminal domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|103486949|ref|YP_616510.1|
Sequence length 335
Comment mandelate racemase/muconate lactonizing protein [Sphingopyxis alaskensis RB2256]
Sequence
MAIRRSSELSLDLRVERFPYHQPFRISGHVFTETALLVAELSDGEHVGRGEGAGVYYLGD
DIEHMLGQATSVRGAIERGATREDLQHLLPPGGARNALDCAFWELEARQTGQPVWRLAGL
DAPRALRSTLTLGADTPERMAAAAQAIDVQAPVKVKLTGDLADDVARIEAIRAARPDAWI
GVDANQGYDVGTLRDLLPVLLAAGVAQLEQPLGRGCEADLDGLKRPLPFVADESALSLAD
TASLVGRFDMVNIKLDKCGGLTEGLAIARQAKTLGLDVMVGNMMGTSLSMAPSCLVGQLC
DIVDLDGPTFLARDRVPGVQYRDGMIHCPAEVWGG
Download sequence
Identical sequences Q1GT45
gi|103486949|ref|YP_616510.1| WP_011541757.1.11395 317655.Sala_1464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]