SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334165|ref|YP_005888112.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334165|ref|YP_005888112.1|
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000229
Family Heat-inducible transcription repressor HrcA, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 96-327
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000333
Family HrcA C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334165|ref|YP_005888112.1|
Sequence length 335
Comment Heat-inducible transcription repressor hrcA [Mycoplasma hyopneumoniae 168]
Sequence
MPKLDSKKEKYLKQIVENFIKTGESIGSLNLKQSYGIKKSPSYLRAIMNQLEKEGFLEKS
HSSSGRIPTLQGFQYYAEFLSFDENENLANKLKDLFARRRINIENTISEAVKLISESVGT
TLIATTNNENERLMSINLTQISQNEGIIVVVSSSGNVENKKITFSEQIPRQDVKIAIRLF
QERLINTPLLEISSKLAILKQELEKQIKHSDELLHHFMEKIFNFQVQNKSNIYNKNSLIL
DKEISRAKLVDLLYIIEKKSIWEMLEDRTTKDDDTLKISIKSPEVSFISKKFEKFLPIKE
ISMVGAAKKINYSAARTGIKLLEDFLSNKSKIRKG
Download sequence
Identical sequences E4QS13 Q4A902 Q4AAT9 Q602E0 S5FZE2
gi|507382432|ref|YP_008025434.1| 262719.MHJ_0010 262722.MHP7448_0010 295358.mhp010 WP_011205849.1.100269 WP_011205849.1.28423 WP_011205849.1.29754 WP_011205849.1.35737 WP_011205849.1.4867 WP_011205849.1.51147 WP_011205849.1.62369 WP_011205849.1.76180 gi|54019979|ref|YP_115525.1| gi|385334165|ref|YP_005888112.1| gi|72080352|ref|YP_287410.1| gi|525903172|ref|YP_008291415.1| gi|71893369|ref|YP_278815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]