SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334185|ref|YP_005888132.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334185|ref|YP_005888132.1|
Domain Number 1 Region: 156-317
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.54e-60
Family GAPDH-like 0.00000282
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.19e-58
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334185|ref|YP_005888132.1|
Sequence length 336
Comment Glyceraldehyde 3-phosphate dehydrogenase [Mycoplasma hyopneumoniae 168]
Sequence
MKKIAINGFGRIGRLALRRLFEVNDENLQVVAINDLTDASVLAHLFKYDSAHGKFNGEVE
VLKDNGKNYLKIKGQKILVLSERDPKSLPWGQLGIDLVVECTGFFASKSGASQHLEAGAK
KVIISAPAGNDVKTIVYNVNCDTITEDDRILSSASCTTNALAPLVNALDKEFGINHGFMT
TIHAYTADQRLQDAPHGDLRRARAAGVNLVPSSTGAAKAIGLVVPSLTGKLDGIAIRVPV
ITGSFVDLSVELKSNPSIEEINQKMREYANESFAYCDEPIVSSDIIGDRHGSIFDATLTK
YIEANGKRLYKLYTWYDNEYSFVSQFVRVIRDFVQK
Download sequence
Identical sequences A0A223M9C1 E4QS33 Q4A8X7 S5FYC0
gi|507382452|ref|YP_008025454.1| gi|385334185|ref|YP_005888132.1| WP_011289957.1.25027 WP_011289957.1.28423 WP_011289957.1.29754 WP_011289957.1.35737 WP_011289957.1.4867 WP_011289957.1.62369 262722.MHP7448_0035 gi|72080377|ref|YP_287435.1| gi|525903198|ref|YP_008291441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]