SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334224|ref|YP_005888171.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334224|ref|YP_005888171.1|
Domain Number 1 Region: 185-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.08e-62
Family Actin/HSP70 0.00000458
Further Details:      
 
Domain Number 2 Region: 378-533
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.96e-57
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000045
Further Details:      
 
Domain Number 3 Region: 27-181
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.91e-53
Family Actin/HSP70 0.0000121
Further Details:      
 
Domain Number 4 Region: 501-595
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000049
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334224|ref|YP_005888171.1|
Sequence length 622
Comment chaperone protein dnaK [Mycoplasma hyopneumoniae 168]
Sequence
MSRKIRQNNTQNSKKLEKGYQKMAKEIILGIDLGTTNSVVAIIENQKPVVLENPNGKRTT
PSVVAFKNNEEIVGDAAKRQLETNPEAIASIKRLMGTDKTVRANERDYKPEEISAKILAY
LKEYAEKKIGHKVTKAVITVPAYFDNAQREATKNAGKIAGLQVERIINEPTAAALAFGLD
KTEKEMKVLVYDLGGGTFDVSVLELSGGTFEVLSTSGDNHLGGDDWDNEIVNWLVKKIKE
EYDFDPKSDKMALTRLKEEAEKTKINLSNQSVSTVSLPFLGMGKNGPINVELELKRSEFE
KMTAHLIDRTRKPIVDALKQAKIEASDLDEVLLVGGSTRMPAVQSMIEHTLNKKPNRSIN
PDEVVAIGAAIQGGVLAGEISDVLLLDVTPLTLGIETLGGIATPLIPRNTTIPVTKSQIF
STAEDNQTEVTISVVQGERQLAADNKMLGRFNLSGIEAAPRGLPQIEVSFSIDVNGITTV
SAKDKKTGKEQTITIKNTSTLSEEEINKMIQEAEENREADALKKDKIETTVRAEGLINQL
EKSITDQGEKIDPKQKELLEKQIQELKDLLKEEKTDELKLKLDQIEAAAQSFAQATAQQA
NTSESDPKADDSNTIDAEIKQD
Download sequence
Identical sequences E4QS72
gi|385334224|ref|YP_005888171.1| gi|507382491|ref|YP_008025493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]