SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334225|ref|YP_005888172.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334225|ref|YP_005888172.1|
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.97e-33
Family Chaperone J-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 118-143,210-274
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000157
Family HSP40/DnaJ peptide-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 139-220
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00000000000000209
Family DnaJ/Hsp40 cysteine-rich domain 0.0014
Further Details:      
 
Domain Number 4 Region: 269-353
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000942
Family HSP40/DnaJ peptide-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334225|ref|YP_005888172.1|
Sequence length 374
Comment chaperone protein dnaJ [Mycoplasma hyopneumoniae 168]
Sequence
MAKQDFYKILGVEKSASLTEIKKAYRNLVNIYHPDKNTKKSAEEQKQAEAKFKEIQEAYE
ILSDETKRKQYDKFGHAAFDQQFGGGSSGFSGFDFGDIFSSFTSGFGFGGSQEQKYSRPL
KGENFQAKIYISFIESILGKEISQKLTKYDQCDNCKGSGANSSSDITTCYNCQGRGMQTE
VLNIPGFGRVQNKTTCSVCLGSGKNITKNCKKCRGKTIVETKEEVTIKIPAGIQDGMFIR
VAGFGGPGHKGGPSGDLHLEINVRQHKHFTRSGNDIHVNMPVSIIDIINQNTVEVPSPTG
LKKVKLYDYYKSGQIVNVLRAGAPDPKNPRIIGDLKVHLIFYIPEFSPRQKDELNQVFAQ
INDKTKAKWLKEFQ
Download sequence
Identical sequences E4QS73 Q4A8U4 S5G5Y8
262722.MHP7448_0068 WP_011289987.1.28423 WP_011289987.1.29754 WP_011289987.1.35737 WP_011289987.1.4867 WP_011289987.1.62369 gi|507382492|ref|YP_008025494.1| gi|525903234|ref|YP_008291477.1| gi|72080410|ref|YP_287468.1| gi|385334225|ref|YP_005888172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]