SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385334251|ref|YP_005888198.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334251|ref|YP_005888198.1|
Domain Number 1 Region: 38-107
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000068
Family Smr domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334251|ref|YP_005888198.1|
Sequence length 110
Comment hypothetical protein MHP168_713 [Mycoplasma hyopneumoniae 168]
Sequence
MKFGKKEKKFHFGYWDEIQKLTIKSNSNIKDFYPYNEKTFDFHGFDRQKTAAVVENLIFE
LKNSKIRCINLISGIGFGHLYEQILDNLRSYEGQFKLDLHNPGLIRVCKN
Download sequence
Identical sequences E4QS99 Q4AAN7 S5G8X6
gi|525903261|ref|YP_008291504.1| WP_014579589.1.28423 WP_014579589.1.29754 WP_014579589.1.35737 WP_014579589.1.4867 WP_014579589.1.62369 WP_014579589.1.76180 gi|385334251|ref|YP_005888198.1| gi|507382518|ref|YP_008025520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]