SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334272|ref|YP_005888219.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334272|ref|YP_005888219.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Ribosomal protein L16p/L10e 6.8e-47
Family Ribosomal protein L16p 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334272|ref|YP_005888219.1|
Sequence length 136
Comment 50S ribosomal protein L16 [Mycoplasma hyopneumoniae 168]
Sequence
MLQPKKTKHRKTFRLYHDKRDAHSGNFVAFGDYGLQATGSAWVSAAQIEAARIAITRRMG
REGQVIIRIFPHLALTSKPIGVRMGSGKGSVDRWVAVVKRNTILFEVRGVKDEIARDALR
LGGHKLPLKWKIVATV
Download sequence
Identical sequences E4QSC0
WP_014579609.1.28423 WP_014579609.1.29754 WP_014579609.1.62369 gi|507382540|ref|YP_008025542.1| gi|385334272|ref|YP_005888219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]