SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334275|ref|YP_005888222.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334275|ref|YP_005888222.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 3.53e-46
Family Ribosomal protein L14 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334275|ref|YP_005888222.1|
Sequence length 122
Comment 50S ribosomal protein L14 [Mycoplasma hyopneumoniae 168]
Sequence
MLQELSRLNVADNTGAKIVGVIRNLGGSVKKTSNIGDIVVVSVKKAIPNGMLKEGQVVKA
LIVRSTYGLRRKNGTHIKFDDNAVVIIKEDGTPRGTRVFGPIAREIREKGYLKIASLAQE
VL
Download sequence
Identical sequences E4QSC3 Q4A8I1 Q4AAF0 Q601K4 S5G000
262719.MHJ_0180 262722.MHP7448_0184 295358.mhp198 gi|507382543|ref|YP_008025545.1| gi|385334275|ref|YP_005888222.1| gi|71893536|ref|YP_278982.1| gi|54020080|ref|YP_115711.1| gi|525903367|ref|YP_008291610.1| WP_011206035.1.100269 WP_011206035.1.28423 WP_011206035.1.29754 WP_011206035.1.35737 WP_011206035.1.4867 WP_011206035.1.51147 WP_011206035.1.62369 WP_011206035.1.76180 gi|72080523|ref|YP_287581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]