SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334282|ref|YP_005888229.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334282|ref|YP_005888229.1|
Domain Number 1 Region: 126-205
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.85e-24
Family Translational machinery components 0.00044
Further Details:      
 
Domain Number 2 Region: 55-123
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.07e-22
Family Ribosomal S5 protein, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334282|ref|YP_005888229.1|
Sequence length 216
Comment 30S ribosomal protein S5 [Mycoplasma hyopneumoniae 168]
Sequence
MDKKLENQKDLLNQDPKVELNSQSVSKNPLNSREVKPIQRRRPLRKNARDKNSKPEFEER
VIAIHRVVKVVKGGRRFSFSAFAVVGNKKGRVGFGHGKANEVQDAVKKAIKDAQNRLVSV
PIYRKSTVPHEIAVKYLASKILIKPAPRGKGIVASNTVRAVVELAGYTDIYTKTYGSRTK
INVVRATLKALLKLRTINQVAELRDLSPQQAQAQKV
Download sequence
Identical sequences E4QSD0
WP_014579615.1.28423 WP_014579615.1.29754 WP_014579615.1.62369 gi|385334282|ref|YP_005888229.1| gi|507382550|ref|YP_008025552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]