SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334312|ref|YP_005888259.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334312|ref|YP_005888259.1|
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Hsp33 domain 8.11e-33
Family Hsp33 domain 0.00098
Further Details:      
 
Domain Number 2 Region: 274-402
Classification Level Classification E-value
Superfamily CinA-like 1.44e-24
Family CinA-like 0.002
Further Details:      
 
Domain Number 3 Region: 220-271
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.000000000115
Family HSP33 redox switch-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334312|ref|YP_005888259.1|
Sequence length 411
Comment hypothetical protein MHP168_155 [Mycoplasma hyopneumoniae 168]
Sequence
MKSQSKIYLYKNVLIIVSEMSQIINEAIKIHQLDNINSLVLASAINVFGPLSYLIKEEKG
GFSIKIFSKNLESLVIETNKNGQIRASFNNKNYKIPDEYFKKYNPNELVGSFVGNSGFLK
INKFGQKNDYSGQVPLQVGDFVSDLAFYFYQSQQTRSAIKNLIEIDQNLKITKAQSLIIQ
LLPNYSESEIQEVESWLKNKKIKDFIEFFENFELIGSKNWTYYCGCDNKNLIENLNLFTE
KEVDDLIKNYQKIEFVCNFCTKTQSFTKKDWVFAKNPFSLATVESLTGGALAAEIVKTKG
ASKFFAGGIVCYQNKIKEKIGIKPENGVTNAKTALKMAEFGQNFFQTKYVISLTGNAGPE
IQDGKLGQVFIALNEKVWELNLEGDRLKIINDCIKFAAEKINEIRPNTIKI
Download sequence
Identical sequences A0A223M9R9 E4QSG0
gi|507382580|ref|YP_008025582.1| WP_014579633.1.25027 WP_014579633.1.28423 WP_014579633.1.62369 gi|385334312|ref|YP_005888259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]