SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334333|ref|YP_005888280.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334333|ref|YP_005888280.1|
Domain Number 1 Region: 8-83,177-350
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.72e-90
Family Pyruvate kinase 0.00000385
Further Details:      
 
Domain Number 2 Region: 78-177
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 3.84e-19
Family Pyruvate kinase beta-barrel domain 0.00055
Further Details:      
 
Domain Number 3 Region: 333-472
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 6.26e-17
Family Pyruvate kinase, C-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334333|ref|YP_005888280.1|
Sequence length 478
Comment Pyruvate kinase [Mycoplasma hyopneumoniae 168]
Sequence
MNDMKNYISKRTKIIATIGPSTQDYEVLKKLVLSGVSVIRANFSHGNYQEQKQKFDSARK
LSNELKIPISIMLDTKGPEIRIGKILEGSQKILANQRLTVLTDSDSYQNFQGTAQIITVS
HQIDKDLKIGDKILFDDGKLQSVVIEIEPGKVVVRTKNSHILKSNKRLNLPGVAFSLPFL
SQKDIDDILFGINENVNYIAASFVNSGENVRELRTLLDQNGGGHIQIISKIESRLGLENI
DEIIELSDGIMIARGDLGLEVPYEEVPFQQKRIIRKCRFAGKTVVVATQMLDSMEKSSQP
TRAEVTDVYWATELGADATMLSGESAQGQFPIESVQVMAVINKRAEKEFYNKLFYAKQLA
VITENSRGLRAKIAHKLAHLAYEKEIKYTVVLSRTGQLLKEIAKFRPNTAVIGVINNEKL
INGFGITSSVFVSINSISEFTAIKNDFSLARNVLGPFGVEKGDTFLVVENEKMVQFVY
Download sequence
Identical sequences E4QSI1
WP_014579649.1.28423 WP_014579649.1.29754 WP_014579649.1.62369 gi|385334333|ref|YP_005888280.1| gi|507382601|ref|YP_008025603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]