SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334356|ref|YP_005888303.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334356|ref|YP_005888303.1|
Domain Number 1 Region: 5-243
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.57e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000384
Further Details:      
 
Domain Number 2 Region: 244-448
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.58e-50
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000398
Further Details:      
 
Domain Number 3 Region: 553-702
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-33
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.031
Further Details:      
 
Domain Number 4 Region: 454-542
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000222
Family AlaX-M N-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334356|ref|YP_005888303.1|
Sequence length 883
Comment alanyl-tRNA synthetase [Mycoplasma hyopneumoniae 168]
Sequence
MEKLSANKIRQLWIDFFREKNHFFIESKPLVPQNDDSLLWINSGVATLKDYFTGKKIPPS
KRLVNSQKALRTNDIENVGLTSRHHTLFEMLGNFSIGDYFKTEAIDYAYEFLTKKLKLDP
KNLFITYYDGDDITFEKWKSLGFSNEKLIKGSRKTNFWDLGQGPCGPCSEIYFDRGPKFD
SRGSELIKNEIENDRFIEIWNIVFSEFNNDGQQNYTPLKSKNIDTGAGFERIVSILQDGP
TNYDTDLFLPIIAEIEKSTVFQYKIENYFLKEPRQTQINKSFRIIADHIRAITLAINDGV
QPSNLHRGYIIRRLIRRAYWNGKKLGISHPFLYKLVEIVGKTLDYRFDIPAISKIILNEE
ENFAKTLEIGYNLLESQLKINKNQIKPVTVFKLFETYGFPVELTKEILAEKNIDFDLSQL
VEFQEKHSQISRAKKTTGMQKVINSLTQIKAKISDFIGYHTHHIETKISFLANKDEEVAE
TSGENLSYVIFEKTPFYATAGGQKHDQGWIVQNNSTIEILDVFKDKFLNNIHVFKGKIVK
NQPVFLKLDTKNRLNLERNHSGTHLLFASLRQEFGSEIKQLGSDNNEDRLTFDFPLNRKP
SDQEIKSVENRINSYINQKIKRKYLVTNLEETQKLNAIMTLEESEYMDPNSLRLVIFDKI
TTDLCGGTHIENTELLEKFTILSCQSKGSGIYRIRAVTSWNKYFEFLKGKIQEILSKISA
LKNKIKKIEPNFGLNLPNLVDLEQQFDYLKKIEDDLRIYYKKLLKSQLRIAKSELDANKI
IEIGKFSFYLDFNLPLHNLKQIAATWREQNPRISFILGANLVNNEFLIIVSSAILASNQI
LEKIFEIFTGSGGGNYKIAQGKIQKKPEKEVFIKLLWENITEF
Download sequence
Identical sequences E4QSK4
gi|385334356|ref|YP_005888303.1| gi|507382623|ref|YP_008025625.1| WP_014579662.1.28423 WP_014579662.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]