SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334357|ref|YP_005888304.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334357|ref|YP_005888304.1|
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.46e-37
Family Putative Holliday junction resolvase RuvX 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334357|ref|YP_005888304.1|
Sequence length 143
Comment Putative Holliday junction resolvase [Mycoplasma hyopneumoniae 168]
Sequence
MGKYNRILALDLGIKTCGFAISDQNWKISYPLEQFNFNRYDFASVISRIAFWMKEYPISI
LVLGYPLTLAGKISPRTKMVEYFADLVKKNYEIKVVFQDERLTTKQAQTFLLDLGISFKK
RQKVIDKLAAQIILERFLNTKKG
Download sequence
Identical sequences A0A223M9X7 E4QSK5 Q4A8G3 Q4AAD2 Q601M3
WP_011206016.1.100269 WP_011206016.1.25027 WP_011206016.1.28423 WP_011206016.1.29754 WP_011206016.1.35737 WP_011206016.1.4867 WP_011206016.1.51147 WP_011206016.1.62369 WP_011206016.1.76180 gi|507382624|ref|YP_008025626.1| 295358.mhp179 gi|54020386|ref|YP_115692.1| gi|385334357|ref|YP_005888304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]