SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385334363|ref|YP_005888310.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334363|ref|YP_005888310.1|
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily HAD-like 6.3e-58
Family Predicted hydrolases Cof 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334363|ref|YP_005888310.1|
Sequence length 276
Comment Hydrolase of the HAD family [Mycoplasma hyopneumoniae 168]
Sequence
MKLFFAFDLDGTLLRYDNTIHPENVEILKKLYELGHFLALATGRGLSGCLDLAKKYPYFH
YLVSNNGTLVHDTKTQKTINNGSLSKEIIFDLIKDCKATDSICAFSSPNNLFEFSSTNNH
PWLKKQKIMDLHFYEKVDQDKLYEIIEKEEITQVAFRNDIPVIAELYKKWSKKLKNIYKV
TITNRIFLDINPLNVDKANGIKMLLEKNNLKPDQLIAFGDSSNDYFMVKLARFGYAMEDS
TPDLLSVAYQKIGNCNSGSIAKTIKSLLEKQEELFS
Download sequence
Identical sequences E4QSL1 Q4AAC6
262719.MHJ_0204 WP_011283987.1.28423 WP_011283987.1.29754 WP_011283987.1.62369 WP_011283987.1.76180 gi|507382630|ref|YP_008025632.1| gi|71893560|ref|YP_279006.1| gi|385334363|ref|YP_005888310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]