SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334383|ref|YP_005888330.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385334383|ref|YP_005888330.1|
Domain Number - Region: 50-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00436
Family Penicillinase repressor 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334383|ref|YP_005888330.1|
Sequence length 329
Comment hypothetical protein MHP168_228 [Mycoplasma hyopneumoniae 168]
Sequence
MDNNNYTIKIDKNQKKGKKISGTNSTYLFYVFWVIRDFEFKKKGEKCKVLDVKQIWEKLN
ANWESKTWNIKTIYKVLNYLIQENIIEVQKIANKLIVVNVLNLKKYYIAKKVLDLSINLE
KLVSANYLKVYQYLKNLAIKNFKLNNWKNSNYSLENSYTYFQNLDLSNETIAKALKWFSE
NNIQIEFENKTISKKLISSVNLDKNTFFKGIKYEKQLISISLKSVKKTLYRQFQNNKAYF
WSKNLFKWKVSKTIVVKIKKFFEYLIKRSCYLIRKTKIGLTYLPCWCQNKGAHWKINCEK
PKYKSFYQEKDLIIRRQGQRNTNLLVLQI
Download sequence
Identical sequences E4QSN1
gi|385334383|ref|YP_005888330.1| WP_014579682.1.28423 WP_014579682.1.29754 WP_014579682.1.62369 gi|507382650|ref|YP_008025652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]