SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334407|ref|YP_005888354.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334407|ref|YP_005888354.1|
Domain Number 1 Region: 42-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.44e-46
Family L-arabinose binding protein-like 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334407|ref|YP_005888354.1|
Sequence length 401
Comment Periplasmic sugar-binding protein [Mycoplasma hyopneumoniae 168]
Sequence
MSKLFIRTLYWVLGLIAAIAIYFGTAFGIASRSNTTAKVAPVAVVFSTRNNPFFQNVEKG
IETAAKELGVDYEVYDSENDSDKEARNISNIIAKQQKVVIFNDVNEDSGISAVKKLNQAG
IPVIATDHLLNSPKALEAKIKVEANIASDNKQAGVILAQFMAQKIGLPQDSLTYSVYGIP
GTESGESRAQGFIETVKNLNNQAIKYNLFSYGKYGKENANGKTYIGRQADDNRDLANQRV
ANDATQVFQDAQKRPLLVFGTNDEAALGSISALESAQIPLGGGDKFLPGSGKVYITGVDY
TNDAQKAVLNNKLSATVEQDTDLLGRLSLIIAEKILKDQWKTSKYSDFYSQFPQLDKDKN
PDDQVEQGYYFKVGTKLFWKGPDGKGEKLQADENGILQKVN
Download sequence
Identical sequences A0A223MA45 E4QSQ5 Q4A8D1 Q4AAA3 Q601Q6 S5G6H7
gi|525903414|ref|YP_008291657.1| gi|54020363|ref|YP_115659.1| 262719.MHJ_0227 262722.MHP7448_0234 295358.mhp145 WP_011205983.1.100269 WP_011205983.1.25027 WP_011205983.1.28423 WP_011205983.1.29754 WP_011205983.1.35737 WP_011205983.1.4867 WP_011205983.1.51147 WP_011205983.1.62369 WP_011205983.1.76180 gi|71893583|ref|YP_279029.1| gi|72080573|ref|YP_287631.1| gi|507382674|ref|YP_008025676.1| gi|385334407|ref|YP_005888354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]