SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334443|ref|YP_005888390.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334443|ref|YP_005888390.1|
Domain Number 1 Region: 23-135,240-338,659-868
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-70
Family Calcium ATPase, transmembrane domain M 0.00063
Further Details:      
 
Domain Number 2 Region: 342-362,463-697
Classification Level Classification E-value
Superfamily HAD-like 1.01e-45
Family Meta-cation ATPase, catalytic domain P 0.00024
Further Details:      
 
Domain Number 3 Region: 134-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-22
Family Calcium ATPase, transduction domain A 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334443|ref|YP_005888390.1|
Sequence length 871
Comment cation-transporting ATPase [Mycoplasma hyopneumoniae 168]
Sequence
MSKKVKNQENNAKSLDLLPFLEQVDREKGLNQEQILFSQTTFGQNSLPKVGEKSLFFRIL
NQLKEPLTLVLIFVIIISILISLIFESDLPFWSKIISYLEPVIIGIIITINVFFSLIQEA
KSKKAIKALSDLNSPVSTIIRQGKKISLNSKDILVGDILEVSAGDLISGDGYILEMKDFA
VSESILTGESTSVYKEKMTNWDNQDCQVFSGSSVLSGNAKILVSAIGAKTKLGKIADLVQ
KTEEASSPLQKKIQKFIKIITFIAAFLAIFFFFVYIFLIASGDFSHFKEGIIVSLSLAIG
FIPEGLVPLVSINLIIGIKKLSKNNAIVKDLKTIETLGAVSIVCSDKTGTITENKMEITD
IFYYQIEQKTFWKQAVLNTSAYSFFQGDIEKFFGDPEEILILKTAKNFEIEKEKLEKEYK
FLDKIPFSSKRKFSAIFYEFNKKKFLFIKGAPEILFKMADNLEQNLNEKLLKMQKLGYRI
FAFGYLEISNSQNFDSNLEKYLKNIKISGLIGFQDPPRKKIKSIINSLTKSQISTVMITG
DNFHTGFAIAKNVGIIKDNSYFVDASNWKKDNFWQENVEKFHLYSRSQPEDKLEIISALQ
AKKQVVAMLGDGVNDAPSLKKADVGFAMGITGSQVSKQVANVILADDNFKTLYLAIKTGR
NIIRNIKQIFAFLLIANFTMLLSVIFATLIFREQIFSSLQILWINVVSETFGGIALGLTN
IVTNVMNKNFLEENQQLFNKKLLLKIGFWAIFITFLGLFSFWITKSSVISFIIISLNLGS
LSYILATNKPIIRYNFSDLKFLHLGFSVSFLSILLVCLTPGLNAVFSPKDFVFSNLIILK
NNNHYFLLFLIPAGIFLDQIWKIFISWQKKR
Download sequence
Identical sequences E4QSU1
WP_014579728.1.28423 WP_014579728.1.29754 gi|385334443|ref|YP_005888390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]