SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334449|ref|YP_005888396.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334449|ref|YP_005888396.1|
Domain Number 1 Region: 42-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1e-25
Family Myf domain 0.0083
Further Details:      
 
Domain Number 2 Region: 479-632
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000149
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.007
Further Details:      
 
Domain Number 3 Region: 390-459
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000696
Family Domains B1 and B5 of PheRS-beta, PheT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334449|ref|YP_005888396.1|
Sequence length 718
Comment phenylalanyl-tRNA synthetase subunit beta [Mycoplasma hyopneumoniae 168]
Sequence
MLFSLRRLKKLANLEAFSDQKVIDSLINLGFEVDQITKLNEISGIKFGQILEIRKNPEAD
NLWICKVQFADKIREIQTAAKNVIENKQVLAFIPGSKSGNTTFLAKKLRGHISEGMLISA
VELGFNKHLLNSELDQGVLVFDPIFDLESNPLKVLELDDLILDIKLLWNRPDGNSYLVLA
NELAAFFKTDFSLINKEISGKFYSELKIINKTDSKIFALEIQKLPKLALVDIFLLLKSEV
KIGNLAQNFSNFILIYTGQPSYCLQLEKHQQKVELIEQKVKIKYEPDAISSYHFLDQEKK
PLLIPEFSDQIIMENNSFFLIMPKFNLLKVKQIKQFLKKNSLKLTQLGKNYNYGTTFIAL
SFLNFFLEDQKIDFSWPINFDKSLISKKTFLDLNYNELKEILGLELSQEDISKTNLILEK
IGYNFDNTSFSPPFYRVDIEFFADYAADFLRFYGLEKLKDCKLEQVKAKIPNPDFEPVKL
KTLGYYETNSFLLISKEENFNPLELKSQDLLTFPSQEHTKIRYSLAWQLAKITKYNQKRK
ITEINLYEKGSIAGWNHSLALASTIYTSEDLKKHLKILYNYDFDFLPADSEFLNPEKSQF
IYLDNVLVGWLGQVAEKYNYENVNFLEILLSKVEKIPKKEGGKIKFRPYDNSQLKYRDIT
LSLPMKDIPDPYLKVIQKIPEIFSVKLINYVIINNQQKITYRITGPDQVCAEIDKFYK
Download sequence
Identical sequences E4QSU7
WP_014579733.1.28423 WP_014579733.1.29754 WP_014579733.1.62369 gi|385334449|ref|YP_005888396.1| gi|507382716|ref|YP_008025718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]