SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334461|ref|YP_005888408.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334461|ref|YP_005888408.1|
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.19e-30
Family Ribosomal protein S16 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334461|ref|YP_005888408.1|
Sequence length 88
Comment 30S ribosomal protein S16 [Mycoplasma hyopneumoniae 168]
Sequence
MVRIRLQRMGSKFNPFYKIVVADARAPRDGRFIEALGYYNPQQKFAKVNLEKTYRWLHIG
AQVTQTVRNIFSKKGVFKNFLEQKSSRA
Download sequence
Identical sequences A0A223MAA8 E4QSV9 Q4A879 Q4AA52 Q601V7 S5G9H9
gi|385334461|ref|YP_005888408.1| gi|72080625|ref|YP_287683.1| gi|71893634|ref|YP_279080.1| gi|54020035|ref|YP_115608.1| 262719.MHJ_0278 262722.MHP7448_0286 295358.mhp094 gi|507382728|ref|YP_008025730.1| gi|525903466|ref|YP_008291709.1| WP_011205932.1.100269 WP_011205932.1.25027 WP_011205932.1.28423 WP_011205932.1.29754 WP_011205932.1.35737 WP_011205932.1.4867 WP_011205932.1.51147 WP_011205932.1.62369 WP_011205932.1.76180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]