SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334537|ref|YP_005888484.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334537|ref|YP_005888484.1|
Domain Number 1 Region: 9-261
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.13e-86
Family Glycerol kinase 0.000000213
Further Details:      
 
Domain Number 2 Region: 263-505
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.5e-69
Family Glycerol kinase 0.000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334537|ref|YP_005888484.1|
Sequence length 510
Comment glycerol kinase [Mycoplasma hyopneumoniae 168]
Sequence
MLKNTAEKFIITLDSGTTSCRSLIFDQKGRVISLVQKEFSQHFPRSGWVEHDPIEIWNTQ
VYTMQAAKTKAGLKSTDFVALGLTNQRETVVLWDKTNGEPVYNAIVWQDRRTSDFCDYLI
EKGYQNYIKEVTGLIINPYFSGTKIRWILKNVKKAKEVLAAGNLLAGTIDSWLLWKLTNG
KVHATDITNASRTMLFDIKKRKWDQKILDLLEIPYSILPKVLASADDFGFVSPFHWSINA
KAKVPIYALIGDQQSALFGQLATEFGMVKNTYGTGCFMLVNTGEKLIKSKNNLLTTVAWQ
IGNNPIQYALEGSVFIAGAAIQWLRDGLSLIENSSDCDSLVSKAKKNDYHIILVPSFTGL
GAPYWDSYSRGAIFGLERGTKKEHLIKASLESIAFQANDLIKAIESDLGTKISLMKVDGG
VSKSDYLMQFQSSISQIEIQRPKNIETTAMGAAFLAGLYAKFWNSLAELKQILVPEKVFV
PEFDQFMVKKLTSNWDLAVRKTLNWKKDIK
Download sequence
Identical sequences E4QT35
gi|385334537|ref|YP_005888484.1| WP_014579812.1.28423 WP_014579812.1.29754 WP_014579812.1.62369 gi|507382803|ref|YP_008025805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]