SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334550|ref|YP_005888497.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334550|ref|YP_005888497.1|
Domain Number 1 Region: 221-248,286-437
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000311
Family Transposase inhibitor (Tn5 transposase) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334550|ref|YP_005888497.1|
Sequence length 508
Comment ISMHp1 transposase [Mycoplasma hyopneumoniae 168]
Sequence
MEKINPNAIQIIKEKLKLFSNLDDKDKIKTTLLDSLKNSAIIEGSVFIGVELIEKLIEKH
NIFESLPKSRHKNMRQIFNYLISKRITDPGSIINAFDKKDDYSNQINTSKNSFYRLLDLV
YESQNQLLDSLNKMVISELGKRDNEFYFDSSTVYFETFERNGLRIPGYSKDAKFKEDQIV
IALACDKNGIPFHIKVFKGNTADSSTLIPFVLDIESKYNIKNMTIIADRGMSTAANIRFL
ESKEYNFIISYRAKIGSQKFKNYLLDPSDYVDLNTDFKYKKEEFYSSYKNKRYTENIRRR
IITYSRKRAIKDSKAREEQIQSFIKKQNKDGFIEVNKLFGKKPKYFREISNMKFELDQSK
IDKDKQFDGYYVYETNILNLNVLDIVEKYQKQWNIEANFRSLKGLLNIRPVFLRIDEHIL
AHTFLCFISLVILKTIIFKINKHISDNKLFANSQLTEVGLVTMLQKLRQRVEFNTLDQQM
IFKNRDGVPSDPNIWNRYDFYFDILINQ
Download sequence
Identical sequences E4QT48
gi|385334550|ref|YP_005888497.1| gi|507382816|ref|YP_008025818.1| gi|507382832|ref|YP_008025834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]