SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334553|ref|YP_005888500.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334553|ref|YP_005888500.1|
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily RNase III domain-like 2.09e-35
Family RNase III catalytic domain-like 0.0009
Further Details:      
 
Domain Number 2 Region: 153-222
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000136
Family Double-stranded RNA-binding domain (dsRBD) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334553|ref|YP_005888500.1|
Sequence length 227
Comment Ribonuclease III [Mycoplasma hyopneumoniae 168]
Sequence
MEIEDKILELLKKLKIIPNSKQIYIQALTHKSYNFINPDKPHYEMLEFLGDSVINYAVSK
VIYDNFYKNEGNSTQIRSLLTSTSSLANATKKVGLMNYVLLGRGASEIRENNKLKADIFE
SFCAAILLDQGFEKLNEFLSEYLYKDVNFDTEKQYKDPKSIFQEKIQTFSTSNKIHYLHT
KLADGTFRVDLIWEKKKYGIGYGRSIKEAEFAAATNALNIFAETEEK
Download sequence
Identical sequences E4QT51
WP_014579828.1.28423 gi|385334553|ref|YP_005888500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]