SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334576|ref|YP_005888523.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334576|ref|YP_005888523.1|
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 6.63e-30
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334576|ref|YP_005888523.1|
Sequence length 159
Comment Pentitol phosphotransferase enzyme II, A component [Mycoplasma hyopneumoniae 168]
Sequence
MSVNLLTSLKENDSILINQTASNWQDAVKISCQPLLDKGLISTEYVHAIIQSTIENGPYY
ILAPFLAMPHAEAGKGVFGNGFSLVVFNKPFYFEADSRPVQILITLAATNSDIHTAVALP
QIVAAFEDVANIEKIKNAQSKEEIITLLEKVDFSKYLET
Download sequence
Identical sequences E4QT74
gi|507382842|ref|YP_008025844.1| gi|385334576|ref|YP_005888523.1| WP_014579846.1.28423 WP_014579846.1.29754 WP_014579846.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]