SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334585|ref|YP_005888532.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334585|ref|YP_005888532.1|
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.18e-46
Family Extended AAA-ATPase domain 0.0000047
Further Details:      
 
Domain Number 2 Region: 244-312
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000286
Family Helicase DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334585|ref|YP_005888532.1|
Sequence length 318
Comment Holliday junction DNA helicase subunit RuvB [Mycoplasma hyopneumoniae 168]
Sequence
MPENLEIRPSSFENFIGQKKLVETLQILISSSQKRKQSLDHILFYGPPGTGKTTLANIVA
NVLEAKIKYVQGPLLEKKSDVLAVLANISPDTIIFIDEIHGINKNIEELLYSAMEEFVID
LQIGVDGERKIMRMKLPQFTLIGASTKLAQISTPLQNRFGYVAKIVDYTLEDMIQIIRNS
SAVLKLKMNTEIIKYIASFSNNTPRIANNLLKRIRDFALVLNAKRIDKDIVNKTFDSIGI
YNQGLSQINIEYLNLLVKIFKGKSVALDVIANVLKEHRQTIINIIEPPLIEKELIEKTSR
GRRITKKGRDYLLELKTN
Download sequence
Identical sequences A0A223MAP7 E4QT83 Q4A7W4 Q4A9R6 Q600N3
WP_011206256.1.100269 WP_011206256.1.25027 WP_011206256.1.28423 WP_011206256.1.29754 WP_011206256.1.4867 WP_011206256.1.51147 WP_011206256.1.62369 WP_011206256.1.76180 gi|507382851|ref|YP_008025853.1| gi|385334585|ref|YP_005888532.1| 295358.mhp422 gi|54020198|ref|YP_115932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]