SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334586|ref|YP_005888533.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385334586|ref|YP_005888533.1|
Domain Number - Region: 376-607
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0607
Family DnaQ-like 3'-5' exonuclease 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334586|ref|YP_005888533.1|
Sequence length 630
Comment hypothetical protein MHP168_432 [Mycoplasma hyopneumoniae 168]
Sequence
MKKINFSHYFRLHTRQKYFIWNNLDSNFPENPDFDEENFENTVWNFEALSENPTDFSELH
INIFKNFTTEFHTFIKKKYPEKKICIVYPAEVEKKIAQTISFYKSGNCDIIFNPCFEYKD
AVAHSSVFFVFNKKLSILKLSTSTKIKDYLAANWNFWITTYALRGFGNDLNPIEEVSYFL
IDTVENPRKNQTEFCETLWVSTNKGVKSVSKIDREGPYYFFAKKIAKQNGLTLLEFNNPY
FLEQNRLVKNLLRNTVSRNSPKGPKKTKKVIKMIPIIDALSEIKEAKNIKTFSPPQISDN
GNFEKNPDFNMLMTKFYPQLANISGTLLKAKDALSLIEDEEKLLMLEKNSFWFNFFQENN
SIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQI
LNQNFSDRNLVFDPKNYTWENFFLIIDKIYHKHADFYVVFNKSYELTRLKEMLEIIFKNY
LERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPFAKYWLVISDLKGCYSIKKIENFITKY
KYNLKRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWETTRKNLQIYCQNDVIAMIMV
WDFLKFIYKNANNASNIKVIKPQKVTLFDN
Download sequence
Identical sequences E4QT84
WP_014579854.1.28423 WP_014579854.1.29754 WP_014579854.1.62369 gi|507382852|ref|YP_008025854.1| gi|385334586|ref|YP_005888533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]