SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334597|ref|YP_005888544.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334597|ref|YP_005888544.1|
Domain Number 1 Region: 7-173
Classification Level Classification E-value
Superfamily PEBP-like 1.24e-23
Family Prokaryotic PEBP-like proteins 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334597|ref|YP_005888544.1|
Sequence length 408
Comment hypothetical protein MHP168_443 [Mycoplasma hyopneumoniae 168]
Sequence
MIKIYIKNVKNGVLDTKFGNGNLGKKYPNSVSFPLKWDKIKAAKSYAVTLIDYEATGELG
FVFIHWIAANIKKNKLKWDDSFARPEKMYQFENSMTRHATNYLLDEFYREHPDGVYFGPL
PPLKDHNYRLEVFALDVENIIPEDLKNRRLFYDDFLELIKNHVLDYGITSFLYRSHGKME
NNLLSKKSISKSELNAPLPKNQENFFLDFQPINFSSEALLPRENDYHVLDLDFLGKQGAS
PFFSARNFDLKIYSESEKIKEYVLIITSFAETNSLGVGLNSWVRVGILKEENDYKTELKP
GKNPYDLFESEYPILNSFGLFCAGSIAQKLGLDSEEKFEFIKSKYGLIYLSGLTSGQGKY
QLEIFGLNSQINWSEIARNSEKPLNSFDVLQTIKSKVIGYNRTFFKLI
Download sequence
Identical sequences E4QT95 Q4A7U0
gi|507382862|ref|YP_008025864.1| gi|385334597|ref|YP_005888544.1| WP_014579864.1.28423 WP_014579864.1.29754 WP_014579864.1.4867 WP_014579864.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]