SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334677|ref|YP_005888624.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334677|ref|YP_005888624.1|
Domain Number 1 Region: 6-294
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.71e-38
Family ROK 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334677|ref|YP_005888624.1|
Sequence length 297
Comment Glucose kinase [Mycoplasma hyopneumoniae 168]
Sequence
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVIDYKKILDKILDLVSKYKINAIAL
CIPGPANYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
KKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYRQIVGDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
Download sequence
Identical sequences E4QTH5
WP_014579931.1.28423 WP_014579931.1.29754 WP_014579931.1.62369 gi|507382941|ref|YP_008025943.1| gi|385334677|ref|YP_005888624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]