SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334694|ref|YP_005888641.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334694|ref|YP_005888641.1|
Domain Number 1 Region: 410-879
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-73
Family DnaQ-like 3'-5' exonuclease 0.00062
Further Details:      
 
Domain Number 2 Region: 329-401
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000432
Family PHP domain 0.021
Further Details:      
 
Domain Number 3 Region: 1409-1442
Classification Level Classification E-value
Superfamily AF1531-like 0.0000051
Family AF1531-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334694|ref|YP_005888641.1|
Sequence length 1469
Comment DNA polymerase III subunit alpha [Mycoplasma hyopneumoniae 168]
Sequence
MNTKFRKFSQLINWTNPYDWDDVVIIEKTSTETIENVNDQSLKTQIFSAIFRKTTLPKFN
DLYAFIDLVQKTNRQSKLINCKIEFDFEIQQNYFPDQQLLEYLNGIMQIISKNKGFFNDK
EIIRANASRFKIIFSDAKSFEFMSKYEKKMRKIIKYFGLIHLDLDFILEEKPVIENKFNL
DLETVMRPLEYNFLANFSERNKKIIDFELIDLKFIRSHKNPNVQFDAQIYKISTIKTKTG
GLILKIFLNNNDYTEAVSVSKFLIKNQNYDLKVGDLVNIKAKIKDLTSRYKSNVDLNLYE
IKKIDSSIFFPNEKLDTAKIKRVEIAARTWKSTMDGISSAKEYVQHALKNGYLAIGIADL
DSVQAFPEFYNAIKSTNIKPIYGSTFSTYRSKIEKVINFNGKNYIFDKLKFVIFDLETTG
LSAFYNEIIEFGAIVLQNGIEIEKHQFFIKPTGKIPSAITKITGISQKMIDETAISWEIA
LEKITKIIKDSVLVAHNAAFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSL
KNVAKRYEIEYDEEIAHRADYDAKILTTIWKNFLAELKSQNINDLTSLSEIKNSIFELRP
EKVFPKQLTIVAKNQIGIKKLYKLVSLANTENLISRPLIFYDHLQKDPDLLIGSGGPESL
LIQTMLYFGPKNVAEFAHIFDFIEIPPPSAFIHLVKREIFTKDQIEDMLKNLINLAKKLQ
IPAVAIGDVRYCLPKEKIFYELYIYAKGVGGVNHVLFDHREKEREDFRNSHIFPEKHFFS
TEELKKEFEFLEDQQLIEEIVVKNSNFVADLIENNIQIIKSGLYPPSFDNSEVKLKEFVY
KKAYEKYGRFLPKLIENRIKTELEPIINQGFHVVYWISKHIVTEAKSQGAIVDSRGSVGS
SIVAFLTGITDVNPLLPHYWCKKCSKVEFPKSQQFLSGYDLPDKNCLDCYKKMEKDGHNI
PFETFLGFNVEKVPDIDLNFSGQTQLKMHDFVRTLFGINKTFRAGTILTNAEKTVYGLAR
KLGEYRARLDPKFDLNREVSYFTSAFLDFLATKAQGVKRTSGKHAGGIIVIPQNQEIEDF
TPINYPANNEKSDWKTTHFDYNALHDNLLKLDILGHDDPTILLHLEKLTNIKSDEIPKSD
PKILSLFRSCKELGISSDQILGEVTGTIGIPEFGTQFVRKMLQIAQVKSFADIVAICGLA
HGTGVWQDNAEKLILEKKHVINELISCRDDIMIYLLQKNIDHQVAFNIMENVRKGKGLTD
QEKELLELKKVPSWYIESLQKIGYLFPKAHAVAYAMKAWKIAYFKLYHPLAFYSSYFSIR
PDVKDLETLIQPAEKIREKINILNKKRLESQKGIQQLSAKEKDLIQFLEISLELKSRGFE
IEKVSLEKSEAQEWIINKENNSLIPPFIAIDGIGDVNARKIVQARNLRPFSSIEDFEKRT
ETNSTSLKKLKELGIFDKISKRAQVNIFD
Download sequence
Identical sequences E4QTJ2
WP_014579941.1.28423 WP_014579941.1.29754 WP_014579941.1.62369 gi|385334694|ref|YP_005888641.1| gi|507382956|ref|YP_008025958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]