SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334699|ref|YP_005888646.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334699|ref|YP_005888646.1|
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000000000136
Family YeaZ-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334699|ref|YP_005888646.1|
Sequence length 163
Comment hypothetical protein MHP168_548 [Mycoplasma hyopneumoniae 168]
Sequence
MVAIFDKNFILIDSKISEIKNKADILPDFLGKILLKNKLEITEFTNFFINLGPGSFTGCR
IGLTFFRTIAQLNKKKIWTCSTFNLLSFKILENKQYFIDYSEKSQFSAFAQNGKITSKIF
EIKKKTEKASQVNYNLIFLNFDKAKKLFKKEVDLINIFPLYIK
Download sequence
Identical sequences E4QTJ7
gi|385334699|ref|YP_005888646.1| gi|507382961|ref|YP_008025963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]